HORDB

ID: hor004676
Uniprot ID: B3H5Q2
Protein name: Protein GOLVEN 8
Gene name: GLV8
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: RGF family
Source: Plant
Expression: In primary roots and mature lateral roots (LRs), expressed in cortex and epidermis from the border of the maturation zone up to the colet . |Expressed in the root portion above the meristem, in sepals and pollen grains, and in cotyledons and leaves lamina
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:0048766 root hair initiation; GO:0080147 root hair cell development; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
GO CC: GO:0005576 extracellular region

Sequence: DYQGPKPRSKPLKNN
Length: 15
Propeptide: MKKWSYAKLMTSALLLVFLSIILLAFHGGSRGDNHLYDHVAIGTKDILMGRKLKDLKPKTESLKMINPKKKNGFEYSDQVSSDLSRQEVFVDMMARDYQGPKPRSKPLKNN
Signal peptide: MKKWSYAKLMTSALLLVFLSIILLAFHGGSRG
Modification: T2 Sulfotyrosine;T11 Hydroxyproline
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004676_AF2.pdb

hor004676_ESM.pdb

Mass:	199185	Formula:	C76H124N24O23
Absent amino acids:	ACEFHIMTVW	Common amino acids:	KP
pI:	10.64	Basic residues:	4
Polar residues:	5	Hydrophobic residues:	1
Hydrophobicity:	-224.67	Boman Index:	-5679
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	26
Instability Index:	1788.67	Extinction Coefficient cystines:	1490
Absorbance 280nm:	106.43