General Information

  • ID:  hor004676
  • Uniprot ID:  B3H5Q2
  • Protein name:  Protein GOLVEN 8
  • Gene name:  GLV8
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  RGF family
  • Source:  Plant
  • Expression:  In primary roots and mature lateral roots (LRs), expressed in cortex and epidermis from the border of the maturation zone up to the colet . |Expressed in the root portion above the meristem, in sepals and pollen grains, and in cotyledons and leaves lamina
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:0048766 root hair initiation; GO:0080147 root hair cell development; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYQGPKPRSKPLKNN
  • Length:  15(97-111)
  • Propeptide:  MKKWSYAKLMTSALLLVFLSIILLAFHGGSRGDNHLYDHVAIGTKDILMGRKLKDLKPKTESLKMINPKKKNGFEYSDQVSSDLSRQEVFVDMMARDYQGPKPRSKPLKNN
  • Signal peptide:  MKKWSYAKLMTSALLLVFLSIILLAFHGGSRG
  • Modification:  T2 Sulfotyrosine;T11 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes root hairs formation and growth.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B3H5Q2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004676_AF2.pdbhor004676_ESM.pdb

Physical Information

Mass: 199185 Formula: C76H124N24O23
Absent amino acids: ACEFHIMTVW Common amino acids: KP
pI: 10.64 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -224.67 Boman Index: -5679
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 26
Instability Index: 1788.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 106.43

Literature

  • PubMed ID:  NA
  • Title:  NA